Evolutionary constraints of the P2Y12 receptor family - Follow the link to view the sequence variation within the P2Y12 receptor family mapped onto a 3-D homology model

Receptor
hP2Y12
Dasypus_novemcinctus
Loxodonta_africana
Bos_taurus
Equus_caballus
Sus_scrofa
Myotis_lucifugus
Pteropus-vampyrus
Canis_familiaris
Felis_catus
Choloepus_hoffmanni
Echinops_telfairi
Erinaceus_europaeus
Monodelphis_domestica
Ornithorhynchus_anatinus
Trichosurus-vulpecula
Callithrix_jacchus
Macaca_fascicularis
Macaca_mulatta
Microcebus_murinus
Otolemur_garnettii
Pan_troglodytes
Pongo_pygmaeus
Tarsius_syrichta
Dipodomys_ordii
Cavia_porcellus
Mus_macedonicus
Mus_mullissinus
Mus_musculus
Mus_spretus
Ochotona_princeps
Oryctolagus_cuniculus
Rattus_norvegicus
Spermophilus_tridecemline
Tursiops_truncatus
Gallus_gallus
Anolis_carolinensis
Osmerus-mordax
Xenopus_tropicalis
Danio-rerio
Gasterosteus-aculeatus
Oryzias-latipes
Takifugu_rubripes
Tetraodon_nigroviridis
Callorhinchus_milii
Consensus
Receptor
TMH1ICL1TMH2ECL1TMH3ICL2TMH4ECL2TMH5ICL3TMH6ECL3TMH7Helix8
-------------------------------------------MQAVDNLTSAPGNTS--LCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGV-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLS--QDNRKKEQDGGDPNEETPM------------
-------------------------------------------MQVIKNLTAAAGNGS--LCTRNYKITQVLFPLLYTVLFFVGLITNCLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRAFVCQVTSVTFYFTMYISISFLGLITIDRYQKTTRPFKSFHPNNLWGAKILSXVIWVFMFFLSLPNMILTNRRPTDK-NVEKCSFLKSEFGLVWHEIVNYICQVIFWINFLIIVVCYTLITKELYRSYVRTRGP-----------------GKVPRKRVSIKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLMSRLKCPNSATSPS--QENKKRGLNGGDPDEETPM------------
----------------------------------------------MDNLTIAAGNSS--LCTRDYKINQVLFPLLYTVLFFIGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAELGTGSLRAFVCQVTSVVFYFTMYISISFLGLITIDRYQRTTRPFKTLKPNNLLGAKVLSVVIWAFMFLLSLPNMILTNKRPRDK-NVKKCSFLKSEFGLVWHEMVNYICQVIF-INFLIIIVCYTLITKELYRSYVRTRGV-----------------GKVPKKKVNIKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLKCSNSATFPA--QEQRKEGQNSGTPSLETPM------------
----------------------------------------------MDNLTSVAGNSS--QCSRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDTKLGTGPLRAFVCQVTSVVFYFTMYISISFLGLITIDRYQKTTRPFKTANPNNLLGAKILSVVIWAFMFLISLPNMILTNRRPSDK-TVKKCSFLKSEFGLVWHEIVNYVCQVIFWINFLIVIVCYTLITKELYKSYVRTRGA-----------------GKVPKKKVNIKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLRCSNSTSPPS--HDNRKKGQDGSDPSEETPM------------
----------------------------------------------MDNLTSVARNSS--LCTRDYKITQVLFPLLYTLLFFVGLIINSLAMRVFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVVFYFTMYISISFLGLITIDRYQKTTRPFKTSNPNNLLGAKILSVVIWAFMFLLSLPNMILTNKRPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGT-----------------GKAPRKRVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCPAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKHSLMAMLKCPNSATSPA--PENRRKAQAGGDPSEETPM------------
----------------------------------------------MENLTSAPGNGS--LCIRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRAFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPNNLLGAKILSVVIWAFMFLLSLPNMILTNRRPSD--NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYKSYVRTRGV-----------------GKVPKKKVNIKVFIIIAVFLICFVPFHFARIPYTLSQTR-DVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLKCSNSASSPX--XRNRKKGQDGDDPSEETPM------------
----------------------------------------------MDNFTSPPGNGS--LCTRDYHITQVLFPLLYTVLFFTGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRVFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSSPNNLLGAKILSVVIWAFMFLLSLPNMILTNRRPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGT-----------------GKVHKKKVNIKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFNCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLKCTNSATSP---HENRGKGQDGRDPSEETPI------------
----------------------------------------------MDNLTSAAGNGS--LCIRDYKITQVLFPLLYTVLFFTGLITNSLAMRIFFQIRSKSNFIIFLKNTVIXDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVTFYFTMYISISFLGLITIDRYQKTTRPFKTSNPNNLLGAKILSVVIWAFMFLLSLPNMILTNRRPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGV-----------------GKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLKCPNSAASPP--HENRKKGQNDGDPSEETPM------------
----------------------------------------------MDNLTSVAGNGS--LCTRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVVFYFTMYISISFLGLITIDRYQKTTRPFKTSSPNNLLGAKILSVVIWAFMFLLSLPNMILTNRRPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGV-----------------GKVPKKKVNIKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMNMLKCQNPATSLS--HENRKKEQDGGDPNEETPM------------
----------------------------------------------MDNLTSVAGNGS--LCTRDYKITQVLFPLLYTVLFFVGLIINSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILXFPFKILSDTKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPNNLLGAKILSVVIWAFMFLISLPNMILTNRRPREK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGV-----------------GKVPRKKVNIKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLKCPNSATSLS--QENRKKEQDGGDPSEETPM------------
-------------------------------------------MQVIDNFTAADGNGS--RCTRDYKITQVLFPLLYIVLFFVGLITNCLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAELGTGSLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFNTSSPNNLLGAKILSVVIWVFMFLLSLPNMILTNRKPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIIIVCYTLITKELYRSYVRTRGV-----------------GKVPRKKVNIKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCSAENTLFYMKESTLWLTSLNACLDPFIYFFLCKSFRNSLITRLKCTNSATSPT--HGNKKKGQNGGDPDEE-PM------------
-----------------MCLRRHPQLPGPKSNSLTSLLPAAPEQADIDNVTAGAAAGNSSLCARHDKITHVLFPLLYTVLFFTGLVTNSLAMKIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAELG--SLRALVCQVTSVVFYFDMYISISFLGLITVDRYQKTTRPFTTASSSRLLGAKVLSGVIGAFMFFLALPNMILTNXRPTDA-SVKKCSFLXSEFGLVWHEIVNYICQVIFWINFXIIVVCYTLITXELYRSYVRARGA-----------------GKVPRKRVNIRVFIIIAVFFVCFVPFHFARIPYTLSQTR-EVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLMSMLRCSKPVTPPD--QGTRNKGQNGSDPSEETPL------------
MSLKPPLSEVPVPLKGYADRQQQNLGLQVTLCLLSLPVGGKQQPWAMENLTSASGNGS--SCSRDYKITQVLFPLLYTILFFVGLITNSLAMRIFFQIQSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRAFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTANPKNLLGAKILSVVIWAFMFLLSLPNMILTNRRPKDK-NVNKCSFLKSEFGLVWHEIVNYICQVIXXINFXSVTVCYTLITTELYRSYVRTRGT-----------------GKAPLKKXNIRXFIIIAVSSVXFVPFHFARIPYTLSQTR-DVFNCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLTCSDSATSPSSSQEKRRKAPDSPEPSEETPI------------
-------------------------------------------MSDFDNFTNGTGNHS--LCTRDYKITQVLFPLLYTVLFVVGITMNSLAMGIFFQIPSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRAFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNLNNPLGAKILSAVIWIFMFLLSLPNMILTNKKPVHL-NVKKCAFLKSDFGLVWHEIVNYICQVIFWINLLIIIVCYTLITKELYRSYVRTRGV-----------------GKAPKKTVNVKVFIVIAVFFICFVPFHFARIPYTLSQTR-DVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFYLCKSFRNSLMSMLRHRNAP-IAS-AQEIRNKGQDNSSPSEEIPL------------
-------------------------------------------MRVSHNFTQAPGNGSS-ICSRDYKITQVLFPVLYTVLFFVGIVMNGLAMRIFFQIPSKSNFIIFLKNTVISDLFMILTFPFKILSDAKLGPGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKAAGLNNLLGTKILSVVIWAFMFLLSLPNMILTNNKPLRA-NVKKCSFLKSEFGLVWHEIVNYVCQVIFWINLVIIIVCYVLITKELYRSYVRTRGV-----------------GKVPRKTVNMKVFIVIAVFFTCFVPFHFARIPYTLSQTRDDVFDCSAENTLFYIKESTLWLTSLNACLDPFIYFFLCKSFRNSLKAMLKRPNDLTFSH--EEMKNKRQESSTPSEETPI------------
-------------------------------------------MSDLYNFTNGTGNYS--LCTRDYKITQVLFPLLYTVLFVVGIIMNSLAMGIFFQIPSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRAFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNLNNLLGAKILSAVIWIFMFLLSLPNMILTNKKPGHS-NVKKCAFLKSEFGLVWHEIVNYICQVIFWINLLIIIVRYTLITKELYRSYVRTRGV-----------------GKAPKKKVNIKVFIVIAVFFICFVPFHFARIPYTLSQTR-DVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFYLCKSFRNSLMGMLRHRNAPTMFS-PQEIRNKGQDNSSPSEDIPL------------
-------------------------------------------MQAIDNLTSVPGNTS--LCTRDYKITQVLFPLLYTILFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITNELYRSYVRTRGV-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCAAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNTAASLS--Q-NREKKQHGGDLNEETPM------------
-------------------------------------------MQAIDNLTSAPGNTS--LCTRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVLIWAFMFLLSLPNMILTNRRPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGV-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCAAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSQS--QDNRKKEQDGGDPNEETPM------------
-------------------------------------------MQAIDNLTSAPGNTS--LCTRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVLIWAFMFLLSLPNMILTNRRPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGV-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCAAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSQS--QDNRKKEQDGGDPNEETPM------------
-------------------------------------------MQALDNLTSVPGNGS--LCTRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPSNLLGAKILSVVIWAFMFLLSLPNMILTNRRPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYKSYVRTRGV-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCAAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMVKCPSSATSSS--QENRKKGQNGGDTSEETPM------------
-------------------------------------------MQAINNLTSEPGNSS--LCTRDHKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFQTANPSNLLGAKILSVLIWAFMFFISLPNMILTNRRPRDK-NVNKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYIRTRGA-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCAAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATS-S--QENRKKGQNSDDPREETPM------------
-------------------------------------------MQAVDNLTSAPGNTS--LCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVTVCYTLITKELYRSYVRTRGV-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLS--QDNRKKEQDGGDPNEETPM------------
-------------------------------------------MQAIDNLTSAPGNTS--LCTRDYKITQVLFTLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNLKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGV-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLS--QDNRKKEQDGGDPNEETPM------------
-------------------------------------------MQVTDNLTSVPGNNS--LCTRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVVFYFTMYISISFLGLITIDRYQKTTRPFQTSNPSNLLGAKILSVVIWAFMFLLSLPNMILTNRRPRDK-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRXRGP-----------------GKVPREKVNVKVFIIIAVFLICVVPFHFARIPYTLSQTR-DVFDCIAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLITMLKCPNSATPSS--QENRKKEQDGSDPSEXTPM------------
-------------------------------------------MQALANVTPAPGNSS--QCSRDYAIAEALFPLLYTGLFFVGLITNSLAMRIFFQINSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGPRPLRAFVCQVTSVVFYFTMYISISFLGLITIDRYQKTTRPFHTSSPRNLLGAKILSAVIWAFMFLLSLPNMILTNRRPRDI-HVKKCSFFKSEFGLVWHEIVNYVCQVIFWINFFIVIVCYTLITKELYRSHVRTRAV-----------------GKVPRKRVSVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCASENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTGMLKCPKSRTSLS--RENRKKGPDGSDP-EETPM------------
-------------------------------------------M-ATSNLTSEPGNSS--LCARDYKITQILFPLLYTVLFFVGLITNSLAMRIFFQINSKSNFIIFLKNTVISDLLMILTFPFKILSDAELGPGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTTNPSNLLGAKILSVVIWAFMFLFSLPNMILTNRRPPGK-IVKKCSFFKSQFGLVWHEIVNYICQVIFWINFLIIIVCYTLITKELYRSYVRTRGV-----------------GKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCAAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLRCHNSEKSSS--QENRKKRQDNSDPSEETPM------------
-------------------------------------MDVPGVNTTSANTTFSPGTST--LCVRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTLVCQVTSVTFYFTMYISISFLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDK-DVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGS-----------------AKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-AVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCSNSTSTS---GANKKKGQEGGEPSEETPM------------
-------------------------------------MDVPGVNTTSANTTFSPGTST--LCVRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTLVCQVTSXTFYFTMYISISFLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDK-DVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGS-----------------AKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-AVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCSNSTSTS---GTNKKKGQEGGEPSEETPM------------
-------------------------------------MDMPGVNTTSANTTFSPGTST--LCVRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTLVCQVTSVTFYFTMYISISFLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDK-DVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGS-----------------AKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-AVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCSNSTSTS---GTNKKKGQEGGEPSEETPM------------
-------------------------------------MDVPVVNTTSANTTFSPGTST--LCVRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGARPLRTLVCQVTSVTFYFTMYISISFLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDK-DVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGS-----------------AKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-AVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCSNSTSTS---GANKKKGQEGGEPSEETPM------------
-------------------------------------------MPAIDNLTAGPRNSS--LCTRDYKITQVLFPLLYTVLFFTGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLR-FVCRXTSVIFYFTMYISISFLGLITIDRYQKTTQPFRTSNSTSLLGAKILSAVIWAFMFLLSLPNMILTNKRPRDS-NEKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYKSYLRTKGV-----------------GKVPRKKVNGKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFNCTAENALFYLKESTLWLTSLNACLDPFIYFFPLQVLQKFPDKHAEVSQLCVTY-----IPRKEEKGTGW------------------
-------------------------------------------MQATDNLTSVPGNSS--VCARDYKITQVLFPLLYTLLFVTGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVVFYFTMYISISFLGLITIDRYQKTTRPFKTSNPTNLLGAKILSVAIWAFMFLLSLPNMILTNKRPRNT-NVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYKSYVRTRGA-----------------GKAPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTR-DVFDCTAENALFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLMSMMKYPNSATSPS--QENRKKGQDGGDPSEETPM------------
-------------------------------------MEVPGANATSANTTSIPGTST--LCSRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGHLRTLVCQVTSVTFYFTMYISISFLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVAIWAFMFLLSLPNMILTNRRPKDK-DITKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGS-----------------AKAPKKRVNIKVFIIIAVFFICFVPFHFARIPYTLSQTR-AVFDCNAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLMSMLRCSTSGAN-------KKKGQEGGDPSEETPM------------
-------------------------------------------MLLSENFTLAPGNSS--MCARNYKITQVLFPLLYTVLFFVGLVTNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGPGPLRTFVCQVTSVVFYFTMYISISFLGLITIDRYQKTTRPFKTSSPQSLLGAKVLSVVIWAFMFLLSLPNMILTNRRPRDK-SIKKCSFLKSEFGLVWHEITNYICQVIFWINFLIVIVCYTLITKELYRSYMRTRGS-----------------SKAPRKKVNVRVFIVIAVFFLCFVPFHFARIPYTLSQTR-EVFDCAAQNTLFYLKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPSSAMAPS--RGDKKKAEGAGDPSEETPM------------
-------------------------------------------MLLSENFTLAPGNSS--MCARNYKITQVLFPLLYTVLFFVGLVTNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGPGPLRTFVCQVTSVVFYFTMYISISFLGLITIDRYQKTTRPFKTSSPQSLLGAKVLSVVIWAFMFLLSLPNMILTNRRPRDK-SIKKCSFLKSEFGLVWHEITNYICQVIFWINFLIVIVCYTLITKELYRSYMRTRGS-----------------SKAPRKKVNVRVFIVIAVFFLCFVPFHFARIPYTLSQTR-EVFDCAAQNTLFYLKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPSSAMAPS--RGDKKKAEGAGDPSEETPM------------
------------------------------------------MQTKATSNFSYSINGS--NCTSDNRIRQVIFPLLYTLLFLVGLTMNGLAMWVFFKISSKSNFIIFLKNTVISDILMILTFPFKILSDAQLVPWVLRGFVCQVSQVVFYFTMYISILFLGLITIDRYQKATSPFRTSTTRSLLGAKILSTAIWILMFILSLPNMILTNKKKTPT-NVKKCALLKSEFGLVWHEAVNYICQLIFWVNLIVIVVCYILISKELYKSYQRTRCT-----------------GRPSRKSVNLKVFIIIAVFFICFVPFHFTRIPYTLSQTR-NVFDCSAVNTLFYLKESTLWLTSLNACLDPFIYFFLCKSFRKSLLGMLCKHTASPE----LQAQIAVQNERDDTEDTPV------------
----------------------------------------------MDPGYSPSGNGS--NCSTDKSMNQVLFPLLYTFIFVVGIIMNGLAMGVFFQIANKSNFIIFLKNTVIADILMILTFPFKILSDAKLVSW